PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa010345
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 377aa    MW: 42488.8 Da    PI: 7.0701
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58686371PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-45074PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.61.3e-334296155
    G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
               kprl+Wtp+LHerF+eav+qLGG++kAtPk++l+lm+++gLtl+h+kSHLQkYRl
  Lsa010345 42 KPRLKWTPDLHERFIEAVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRL 96
               79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.383999IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-314097IPR009057Homeodomain-like
SuperFamilySSF466897.17E-174197IPR009057Homeodomain-like
TIGRFAMsTIGR015576.1E-244297IPR006447Myb domain, plants
PfamPF002492.1E-104495IPR001005SANT/Myb domain
PfamPF143791.5E-24144190IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MYHHHHQGKD IQSSSRMSIT PDRHLFLQGG GDSGLVLSTD AKPRLKWTPD LHERFIEAVN  60
QLGGADKATP KSVLKLMGIQ GLTLYHLKSH LQKYRLSKNL YRQTNSGGTN KVDMVAPTGD  120
DIGETNGSHM SSSSVFPQTN KNLQISEAIQ MQIEVQRRLH EQLEVQRHLQ LRIEAQGKYL  180
QSVLEKAQET LGSQNLGTVG LEAAKVQLSE LVSKVSTHCL NSTFPGIKDV SIQTNQPTDC  240
SIDSCLTYCE GQQNEQDMMG LTLLKSKKVD NEPENVWCED TNRNKKFDLS MSVGGLKTSE  300
WNTSRSYTEE RFMDRDEEAI LMNQNNQKKT HSVKLEKVEM SQKFQLPYFG QKLDLNVHDG  360
NDAASSHKQF DLNGLSW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002525443.11e-162PREDICTED: uncharacterized protein LOC8276523
TrEMBLA0A124SAX90.0A0A124SAX9_CYNCS; MYB-CC type transcription factor, LHEQLE-containing domain-containing protein
STRINGPOPTR_0013s05670.11e-154(Populus trichocarpa)